>3ag4_L mol:protein length:47  Cytochrome c oxidase subunit 7C
SHYEEGPGKNIPFSVENKWRLLAMMTLFFGSGFAAPFFIVRHQLLKK