>3ag4_Q mol:protein length:147  Cytochrome c oxidase subunit 4 isoform 1
AHGSVVKSEDYALPSYVDRRDYPLPDVAHVKNLSASQKALKEKEKASWSSLSIDEKVEL
YRLKFKESFAEMNRSTNEWKTVVGAAMFFIGFTALLLIWEKHYVYGPIPHTFEEEWVAK
QTKRMLDMKVAPIQGFSAKWDYDKNEWKK