>3ag4_R mol:protein length:109  Cytochrome c oxidase subunit 5A
SHGSHETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLN
DFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV