>3ag4_W mol:protein length:59  Cytochrome c oxidase polypeptide 7A1
FENRVAEKQKLFQEDNGLPVHLKGGATDNILYRVTMTLCLGGTLYSLYCLGWASFPHKK