>3ate_A mol:protein length:208  Potassium inwardly-rectifying channel, subfamily J, member 6
GSHMRKIQRYVRKDGKCNVHHGNVREKRAETLVFSTHAVISMRDGKLCLMFRVGDLRNS
HIVEASIRAKLIKSKQTSEGEFIPLNQTDINVGYYTGDDRLFLVSPLIISHEINQQSPF
WEISKAQLPKEELEIVVILEGMVEATGMTCQARSSYITSEILWGYRFTPVLTLEDGFYE
VDYNSFHETYETSTPSLSAKELAELANRAEL