>3bfo_D mol:protein length:91  Mucosa-associated lymphoid tissue lymphoma translocation protein 1 (Isoform 2)
GSKLQICVEPTSQKLMPGSTLVLQCVAVGSPIPHYQWFKNELPLTHETKKLYMVPYVDL
EHQGTYWCHVYNDRDSQDSKKVEIIIDELNNL
>3bfo_A mol:protein length:91  Mucosa-associated lymphoid tissue lymphoma translocation protein 1 (Isoform 2)
GSKLQICVEPTSQKLMPGSTLVLQCVAVGSPIPHYQWFKNELPLTHETKKLYMVPYVDL
EHQGTYWCHVYNDRDSQDSKKVEIIIDELNNL
>3bfo_D mol:protein length:91  Mucosa-associated lymphoid tissue lymphoma translocation protein 1 (Isoform 2)
GSKLQICVEPTSQKLMPGSTLVLQCVAVGSPIPHYQWFKNELPLTHETKKLYMVPYVDL
EHQGTYWCHVYNDRDSQDSKKVEIIIDELNNL
>3bfo_C mol:protein length:91  Mucosa-associated lymphoid tissue lymphoma translocation protein 1 (Isoform 2)
GSKLQICVEPTSQKLMPGSTLVLQCVAVGSPIPHYQWFKNELPLTHETKKLYMVPYVDL
EHQGTYWCHVYNDRDSQDSKKVEIIIDELNNL
>3bfo_B mol:protein length:91  Mucosa-associated lymphoid tissue lymphoma translocation protein 1 (Isoform 2)
GSKLQICVEPTSQKLMPGSTLVLQCVAVGSPIPHYQWFKNELPLTHETKKLYMVPYVDL
EHQGTYWCHVYNDRDSQDSKKVEIIIDELNNL