>3bjy_P mol:na length:12  DNA (5'-D(*DAP*DTP*DCP*DCP*DTP*DCP*DCP*DCP*DCP*DTP*DAP*(DOC))-3')
ATCCTCCCCTAC
>3bjy_A mol:protein length:434  DNA repair protein REV1
KRIVACDDPDFLTSYFAHSRLHHLSAWKANLKDKFLNENIHKYTKITDKDTYIIFHIDF
DCFFATVAYLCRSSSFSACDFKRDPIVVCHGTKNSDIASCNYVARSYGIKNGMWVSQAE
KMLPNGIKLISLPYTFEQFQLKSEAFYSTLKRLNIFNLILPISIDEAVCVRIIPDNIHN
TNTLNARLCEEIRQEIFQGTNGCTVSIGCSDSLVLARLALKMAKPNGYNITFKSNLSEE
FWSSFKLDDLPGVGHSTLSRLESTFDSPHSLNDLRKRYTLDALKASVGSKLGMKIHLAL
QGQDDEESLKILYDPKEVLQRKSLSIDINWGIRFKNITQVDLFIERGCQYLLEKLNEIN
KTTSQITLKLMRRCKDAPIEPPKYMGMGRCDSFSRSSRLGIPTNEFGIIATEMKSLYRT
LGCPPMELRGLALQFNKLVDV
>3bjy_P mol:na length:12  DNA (5'-D(*DAP*DTP*DCP*DCP*DTP*DCP*DCP*DCP*DCP*DTP*DAP*(DOC))-3')
ATCCTCCCCTAC
>3bjy_T mol:na length:16  DNA (5'-D(*DTP*DAP*DAP*(P)P*DGP*DTP*DAP*DGP*DGP*DGP*DGP*DAP*DGP*DGP*DAP*DT)-3')
TAAPGTAGGGGAGGAT