>3bsu_F mol:protein length:53  Ribonuclease H1
GSHMFYAVRRGRKTGVFLTWNECRAQVDRFPAARFKKFATEDEAWAFVRKSAS