>3bsu_G mol:protein length:53  Ribonuclease H1
GSHMFYAVRRGRKTGVFLTWNECRAQVDRFPAARFKKFATEDEAWAFVRKSAS