>3buc_A mol:protein length:203  Alpha-ketoglutarate-dependent dioxygenase alkB homolog 2
SWRHIRAEGLDSSYTVLFGKAEADEIFQELEKEVEYFTGALARVQVFGKWHSVPRKQAT
YGDAGLTYTFSGLTLSPKPWIPVLERIRDHVSGVTGQTFNFVLINRYKDGSDHICEHRD
DERELAPGSPIASVSFGASRDFVFRHKDSRGKSPSRRVAVVRLPLAHGSLLMMNHPTNT
HWYHSLPVRKKVLAPRVNLTFRKILL
>3buc_C mol:na length:13  DNA (5'-D(*DTP*DCP*DGP*DCP*DAP*DGP*DTP*DTP*DAP*DTP*DAP*DCP*DA)-3')
TCGCAGTTATACA
>3buc_B mol:na length:13  DNA (5'-D(*DCP*DTP*DGP*DTP*DAP*DTP*(MA7)P*DAP*DCP*DTP*DGP*DCP*DG)-3')
CTGTATAACTGCG
>3buc_C mol:na length:13  DNA (5'-D(*DTP*DCP*DGP*DCP*DAP*DGP*DTP*DTP*DAP*DTP*DAP*DCP*DA)-3')
TCGCAGTTATACA