>3c5h_A mol:protein length:255  Glucocorticoid receptor DNA-binding factor 1
MHHHHHHSSGRENLYFQGTYNISVVGLSGTEKEKGQCGIGKSCLCNRFVRPSADEFHLD
HTSVLSTSDFGGRVVNNDHFLYWGEVSRSLEDCVECKMHIVEQTEFIDDQTFQPHRSTA
LQPYIKRAAATKLASAEKLMYFCTDQLGLEQDFEQKQMPDGKLLVDGFLLGIDVSRGMN
RNFDDQLKFVSNLYNQLAKTKKPIVVVLTKCDEGVERYIRDAHTFALSKKNLQVVETSA
RSNVNVDLAFSTLVQLIDK