>3cei_B mol:protein length:213  Superoxide dismutase
MFTLRELPFAKDSMGDFLSPVAFDFHHGKHHQTYVNNLNNLIKGTDFEKSSLFAILTKS
SGGVFNNAAQIYNHDFYWDCLSPKATALSDELKGALEKDFGSLEKFKEDFIKSATTLFG
SGWNWAAYNLDTQKIEIIQTSNAQTPVTDKKVPLLVVDVWEHAYYIDHKNARPVYLEKF
YGHINWHFVSQCYEWAKKEGLGSVDYYINELVHKKL
>3cei_B mol:protein length:213  Superoxide dismutase
MFTLRELPFAKDSMGDFLSPVAFDFHHGKHHQTYVNNLNNLIKGTDFEKSSLFAILTKS
SGGVFNNAAQIYNHDFYWDCLSPKATALSDELKGALEKDFGSLEKFKEDFIKSATTLFG
SGWNWAAYNLDTQKIEIIQTSNAQTPVTDKKVPLLVVDVWEHAYYIDHKNARPVYLEKF
YGHINWHFVSQCYEWAKKEGLGSVDYYINELVHKKL
>3cei_A mol:protein length:213  Superoxide dismutase
MFTLRELPFAKDSMGDFLSPVAFDFHHGKHHQTYVNNLNNLIKGTDFEKSSLFAILTKS
SGGVFNNAAQIYNHDFYWDCLSPKATALSDELKGALEKDFGSLEKFKEDFIKSATTLFG
SGWNWAAYNLDTQKIEIIQTSNAQTPVTDKKVPLLVVDVWEHAYYIDHKNARPVYLEKF
YGHINWHFVSQCYEWAKKEGLGSVDYYINELVHKKL