>3cjr_A mol:protein length:254  Ribosomal protein L11 methyltransferase
MWVYRLKGTLEALDPILPGLFDGGARGLWEREGEVWAFFPAPVDLPYEGVWEEVGDEDW
LEAWRRDLKPALAPPFVVLAPWHTWEGAEIPLVIEPGMAFGTGHHETTRLALKALARHL
RPGDKVLDLGTGSGVLAIAAEKLGGKALGVDIDPMVLPQAEANAKRNGVRPRFLEGSLE
AALPFGPFDLLVANLYAELHAALAPRYREALVPGGRALLTGILKDRAPLVREAMAGAGF
RPLEEAAEGEWVLLAYGR
>3cjr_B mol:protein length:147  50S ribosomal protein L11
MKKVVAVVKLQLPAGKATPAPPVGPALGQHGANIMEFVAAFNAATANMGDAIVPVEITI
YADRSFTFVTKTPPASYLIRKAAGLEKGAHKPGREKVGRITWEQVLEIAKQKMPDLNTT
DLEAAARMIAGSARSMGVEVVGAPEVKDA
>3cjr_B mol:protein length:147  50S ribosomal protein L11
MKKVVAVVKLQLPAGKATPAPPVGPALGQHGANIMEFVAAFNAATANMGDAIVPVEITI
YADRSFTFVTKTPPASYLIRKAAGLEKGAHKPGREKVGRITWEQVLEIAKQKMPDLNTT
DLEAAARMIAGSARSMGVEVVGAPEVKDA