>3cjr_B mol:protein length:147  50S ribosomal protein L11
MKKVVAVVKLQLPAGKATPAPPVGPALGQHGANIMEFVAAFNAATANMGDAIVPVEITI
YADRSFTFVTKTPPASYLIRKAAGLEKGAHKPGREKVGRITWEQVLEIAKQKMPDLNTT
DLEAAARMIAGSARSMGVEVVGAPEVKDA