>3cjs_A mol:protein length:59  Ribosomal protein L11 methyltransferase
MWVYRLKGTLEALDPILPGLFDGGARGLWEREGEVWAFFPAPVDLPYEGVWEEVGDEDW