>3cjs_C mol:protein length:72  50S ribosomal protein L11
MKKVVAVVKLQLPAGKATPAPPVGPALGQHGANIMEFVKAFNAATANMGDAIVPVEITI
YADRSFTFVTKTP