>3cy3_B mol:protein length:14  Pimtide peptide
ARKRRRHPSGPPTA
>3cy3_B mol:protein length:14  Pimtide peptide
ARKRRRHPSGPPTA
>3cy3_A mol:protein length:314  Serine/threonine-protein kinase pim-1
SMLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRV
SDNLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFV
LILERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILID
LNRGELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDM
VCGDIPFEHDEEIIGGQVFFRQRVSSECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVL
LPQETAEIHLHSLSPGPSK