>3d9m_Z mol:protein length:14  CTD-PEPTIDE
YSPTSPSYSPTSPS
>3d9m_B mol:protein length:145  RNA-binding protein 16
MEAVKTFNSELYSLNDYKPPISKAKMTQITKAAIKAIKFYKHVVQSVEKFIQKCKPEYK
VPGLYVIDSIVRQSRHQFGQEKDVFAPRFSNNIISTFQNLYRCPGDDKSKIVRVLNLWQ
KNNVFKSEIIQPLLDMAAALEHHHHHH
>3d9m_Z mol:protein length:14  CTD-PEPTIDE
YSPTSPSYSPTSPS
>3d9m_Y mol:protein length:14  CTD-PEPTIDE
YSPTSPSYSPTSPS
>3d9m_A mol:protein length:145  RNA-binding protein 16
MEAVKTFNSELYSLNDYKPPISKAKMTQITKAAIKAIKFYKHVVQSVEKFIQKCKPEYK
VPGLYVIDSIVRQSRHQFGQEKDVFAPRFSNNIISTFQNLYRCPGDDKSKIVRVLNLWQ
KNNVFKSEIIQPLLDMAAALEHHHHHH