>3d9m_A mol:protein length:145  RNA-binding protein 16
MEAVKTFNSELYSLNDYKPPISKAKMTQITKAAIKAIKFYKHVVQSVEKFIQKCKPEYK
VPGLYVIDSIVRQSRHQFGQEKDVFAPRFSNNIISTFQNLYRCPGDDKSKIVRVLNLWQ
KNNVFKSEIIQPLLDMAAALEHHHHHH