>3d9m_B mol:protein length:145  RNA-binding protein 16
MEAVKTFNSELYSLNDYKPPISKAKMTQITKAAIKAIKFYKHVVQSVEKFIQKCKPEYK
VPGLYVIDSIVRQSRHQFGQEKDVFAPRFSNNIISTFQNLYRCPGDDKSKIVRVLNLWQ
KNNVFKSEIIQPLLDMAAALEHHHHHH