>3dag_A mol:protein length:358  5,10-methenyltetrahydromethanopterin hydrogenase
MKIAILGAGCYRTHAAAGITNFMRACEVAKEVGKPEIALTHSSITYGAELLHLVPDVKE
VIVSDPCFAEEPGLVVIDEFDPKEVMEAHLSGNPESIMPKIREVVKAKAKELPKPPKAC
IHLVHPEDVGLKVTSDDREAVEGADIVITWLPKGNKQPDIIKKFADAIPEGAIVTHACT
IPTTKFAKIFKDLGREDLNITSYHPGCVPEMKGQVYIAEGYASEEAVNKLYEIGKIARG
KAFKMPANLIGPVCDMCSAVTATVYAGLLAYRDAVTKILGAPADFAQMMADEALTQIHN
LMKEKGIANMEEALDPAALLGTADSMCFGPLAEILPTALKVLEVHKVVEEEGKTKCEIM
SQKE
>3dag_A mol:protein length:358  5,10-methenyltetrahydromethanopterin hydrogenase
MKIAILGAGCYRTHAAAGITNFMRACEVAKEVGKPEIALTHSSITYGAELLHLVPDVKE
VIVSDPCFAEEPGLVVIDEFDPKEVMEAHLSGNPESIMPKIREVVKAKAKELPKPPKAC
IHLVHPEDVGLKVTSDDREAVEGADIVITWLPKGNKQPDIIKKFADAIPEGAIVTHACT
IPTTKFAKIFKDLGREDLNITSYHPGCVPEMKGQVYIAEGYASEEAVNKLYEIGKIARG
KAFKMPANLIGPVCDMCSAVTATVYAGLLAYRDAVTKILGAPADFAQMMADEALTQIHN
LMKEKGIANMEEALDPAALLGTADSMCFGPLAEILPTALKVLEVHKVVEEEGKTKCEIM
SQKE