>3dcg_D mol:protein length:97  Transcription elongation factor B polypeptide 1
MMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVC
MYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC