>3dox_Q mol:protein length:3  A PEPTIDE SUBSTRATE-PIV
PIV
>3dox_Q mol:protein length:3  A PEPTIDE SUBSTRATE-PIV
PIV
>3dox_P mol:protein length:4  A PEPTIDE SUBSTRATE-SQNY
SQNY
>3dox_A mol:protein length:203  HIV-1 PROTEASE
PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQY
DQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGMTLNFGGSSGPQVTLWQRPLVTIK
IGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIG
TVLVGPTPVNIIGRNLLTQIGATLNF