>3e17_A mol:protein length:88  Tight junction protein ZO-2
MIGVLLMKSRANEEYGLRLGSQIFVKEMTRTGLATKDGNLHEGDIILKINGTVTENMSL
TDARKLIEKSRGKLQLVVLRDLEHHHHHH