>3exg_W mol:protein length:382  Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial
MGSSHHHHHHSSGLVPRGSHMFANDATFEIKKCDLHRLEEGPPVTTVLTREDGLKYYRM
MQTVRRMELKADQLYKQKIIRGFCHLCDGQEACCVGLEAGINPTDHLITAYRAHGFTFT
RGLSVREILAELTGRKGGCAKGKGGSMHMYAKNFYGGNGIVGAQVPLGAGIALACKYNG
KDEVCLTLYGDGAANQGQIFEAYNMAALWKLPCIFICENNRYGMGTAVERAAASTDYYK
RGDFIPGLRVDGMDILCVREATRFAAAYCRSGKGPILMELQTYRYHGHSMSDPGVAYRT
REEIQEVRSKSDPIMLLKDRMVNSNLASVEELKEIDVEVRKEIEDAAQFATADPEPPLE
ELGYHIYSSDPPFEVRGANQWIKFKSVS