>3f40_A mol:protein length:114  uncharacterized NTF2-like protein
GMKTQITTRDLVLEFIHALNTENFPAAKKRLNENFTFNGPMGHREGSERYMNDMEKMKF
KYVVHKMFEEGNDVCLIYDINMNGKTIAASGLYHLEKGEITSLHVYFDPRPLFEE