>3f5o_F mol:protein length:148  Thioesterase superfamily member 2
MTSMTQSLREVIKAMTKARNFERVLGKITLVSAAPGKVICEMKVEEEHTNAIGTLHGGL
TATLVDNISTMALLCTERGAPGVSVDMNITYMSPAKLGEDIVITAHVLKQGKTLAFTSV
DLTNKATGKLIAQGRHTKHLGNLEHHHHHH
>3f5o_D mol:protein length:148  Thioesterase superfamily member 2
MTSMTQSLREVIKAMTKARNFERVLGKITLVSAAPGKVICEMKVEEEHTNAIGTLHGGL
TATLVDNISTMALLCTERGAPGVSVDMNITYMSPAKLGEDIVITAHVLKQGKTLAFTSV
DLTNKATGKLIAQGRHTKHLGNLEHHHHHH
>3f5o_A mol:protein length:148  Thioesterase superfamily member 2
MTSMTQSLREVIKAMTKARNFERVLGKITLVSAAPGKVICEMKVEEEHTNAIGTLHGGL
TATLVDNISTMALLCTERGAPGVSVDMNITYMSPAKLGEDIVITAHVLKQGKTLAFTSV
DLTNKATGKLIAQGRHTKHLGNLEHHHHHH
>3f5o_H mol:protein length:148  Thioesterase superfamily member 2
MTSMTQSLREVIKAMTKARNFERVLGKITLVSAAPGKVICEMKVEEEHTNAIGTLHGGL
TATLVDNISTMALLCTERGAPGVSVDMNITYMSPAKLGEDIVITAHVLKQGKTLAFTSV
DLTNKATGKLIAQGRHTKHLGNLEHHHHHH
>3f5o_H mol:protein length:148  Thioesterase superfamily member 2
MTSMTQSLREVIKAMTKARNFERVLGKITLVSAAPGKVICEMKVEEEHTNAIGTLHGGL
TATLVDNISTMALLCTERGAPGVSVDMNITYMSPAKLGEDIVITAHVLKQGKTLAFTSV
DLTNKATGKLIAQGRHTKHLGNLEHHHHHH
>3f5o_E mol:protein length:148  Thioesterase superfamily member 2
MTSMTQSLREVIKAMTKARNFERVLGKITLVSAAPGKVICEMKVEEEHTNAIGTLHGGL
TATLVDNISTMALLCTERGAPGVSVDMNITYMSPAKLGEDIVITAHVLKQGKTLAFTSV
DLTNKATGKLIAQGRHTKHLGNLEHHHHHH
>3f5o_B mol:protein length:148  Thioesterase superfamily member 2
MTSMTQSLREVIKAMTKARNFERVLGKITLVSAAPGKVICEMKVEEEHTNAIGTLHGGL
TATLVDNISTMALLCTERGAPGVSVDMNITYMSPAKLGEDIVITAHVLKQGKTLAFTSV
DLTNKATGKLIAQGRHTKHLGNLEHHHHHH
>3f5o_G mol:protein length:148  Thioesterase superfamily member 2
MTSMTQSLREVIKAMTKARNFERVLGKITLVSAAPGKVICEMKVEEEHTNAIGTLHGGL
TATLVDNISTMALLCTERGAPGVSVDMNITYMSPAKLGEDIVITAHVLKQGKTLAFTSV
DLTNKATGKLIAQGRHTKHLGNLEHHHHHH
>3f5o_C mol:protein length:148  Thioesterase superfamily member 2
MTSMTQSLREVIKAMTKARNFERVLGKITLVSAAPGKVICEMKVEEEHTNAIGTLHGGL
TATLVDNISTMALLCTERGAPGVSVDMNITYMSPAKLGEDIVITAHVLKQGKTLAFTSV
DLTNKATGKLIAQGRHTKHLGNLEHHHHHH