>3f5o_C mol:protein length:148  Thioesterase superfamily member 2
MTSMTQSLREVIKAMTKARNFERVLGKITLVSAAPGKVICEMKVEEEHTNAIGTLHGGL
TATLVDNISTMALLCTERGAPGVSVDMNITYMSPAKLGEDIVITAHVLKQGKTLAFTSV
DLTNKATGKLIAQGRHTKHLGNLEHHHHHH