>3fa6_B mol:protein length:137  Cellular retinoic acid-binding protein 2
PNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKVSTTVR
TTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTLELTNDGE
LIDTMTADDVVCTKVFVRE