>3fa9_A mol:protein length:137  Cellular retinoic acid-binding protein 2
PNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVR
TTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTLELTNDGE
LIDTMTADDVVCTKVFVRE
>3fa9_B mol:protein length:137  Cellular retinoic acid-binding protein 2
PNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVR
TTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTLELTNDGE
LIDTMTADDVVCTKVFVRE
>3fa9_B mol:protein length:137  Cellular retinoic acid-binding protein 2
PNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVR
TTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTLELTNDGE
LIDTMTADDVVCTKVFVRE