>3fk2_B mol:protein length:246  Glucocorticoid receptor DNA-binding factor 1
MHHHHHHSSGRENLYFQGDPRRRNILRSLRRNTKKPKPKPRPSITKATWESNYFGVPLT
TVVTPEKPIPIFIERCIEYIEATGLSTEGIYRVSGNKSEMESLQRQFDQDHNLDLAEKD
FTVNTVAGAMKSFFSELPDPLVPYNMQIDLVEAHKINDREQKLHALKEVLKKFPKENHE
VFKYVISHLNKVSHNNKVNLMTSENLSICFWPTLMRPDFSTMDALTATRTYQTIIELFI
QQCPFFFYNR