>3fya_A mol:protein length:99  Regulatory protein
MGSSHHHHHHSSGLVPRGSHMESFLLSKVSFVIKKIRLEKGMTQEDLAYKSNLDATYIS
GIERNSRNLTIKSLELIMKGLEVSDVVFFEMLIKEILKHD