>3fya_B mol:protein length:99  Regulatory protein
MGSSHHHHHHSSGLVPRGSHMESFLLSKVSFVIKKIRLEKGMTQEDLAYKSNLDATYIS
GIERNSRNLTIKSLELIMKGLEVSDVVFFEMLIKEILKHD