>3g0h_A mol:protein length:424  ATP-dependent RNA helicase DDX19B
SMEDRAAQSLLNKLIRSNLVDNTNQVEVLQRDPNSPLYSVKSFEELRLKPQLLQGVYAM
GFNRPSKIQENALPLMLAEPPQNLIAQSQSGTGKTAAFVLAMLSQVEPANKYPQCLCLS
PTYELALQTGKVIEQMGKFYPELKLAYAVRGNKLERGQKISEQIVIGTPGTVLDWCSKL
KFIDPKKIKVFVLDEADVMIATQGHQDQSIRIQRMLPRNCQMLLFSATFEDSVWKFAQK
VVPDPNVIKLKREEETLDTIKQYYVLCSSRDEKFQALCNLYGAITIAQAMIFCHTRKTA
SWLAAELSKEGHQVALLSGEMMVEQRAAVIERFREGKEKVLVTTNVCARGIDVEQVSVV
INFDLPVDKDGNPDNETYLHRIGRTGRFGKRGLAVNMVDSKHSMNILNRIQEHFNKKIE
RLDTDDLDEIE
>3g0h_E mol:na length:7  5'-R(P*UP*UP*UP*UP*UP*UP*U)-3'
UUUUUUU
>3g0h_E mol:na length:7  5'-R(P*UP*UP*UP*UP*UP*UP*U)-3'
UUUUUUU