>3g2u_D mol:protein length:13  C-terminal fragment of Sortilin
SGYHDDSDEDLLE
>3g2u_D mol:protein length:13  C-terminal fragment of Sortilin
SGYHDDSDEDLLE
>3g2u_C mol:protein length:13  C-terminal fragment of Sortilin
SGYHDDSDEDLLE
>3g2u_A mol:protein length:149  ADP-ribosylation factor-binding protein GGA1
GSMEPAMEPETLEARINRATNPLNKELDWASINGFCEQLNEDFEGPPLATRLLAHKIQS
PQEWEAIQALTVLETCMKSCGKRFHDEVGKFRFLNELIKVVSPKYLGSRTSEKVKNKIL
ELLYSWTVGLPEEVKIAEAYQMLKKQGIVKS
>3g2u_B mol:protein length:149  ADP-ribosylation factor-binding protein GGA1
GSMEPAMEPETLEARINRATNPLNKELDWASINGFCEQLNEDFEGPPLATRLLAHKIQS
PQEWEAIQALTVLETCMKSCGKRFHDEVGKFRFLNELIKVVSPKYLGSRTSEKVKNKIL
ELLYSWTVGLPEEVKIAEAYQMLKKQGIVKS