>3g2v_A mol:protein length:149  ADP-ribosylation factor-binding protein GGA1
GSMEPAMEPETLEARINRATNPLNKELDWASINGFCEQLNEDFEGPPLATRLLAHKIQS
PQEWEAIQALTVLETCMKSCGKRFHDEVGKFRFLNELIKVVSPKYLGSRTSEKVKNKIL
ELLYSWTVGLPEEVKIAEAYQMLKKQGIVKS