>3g3b_G mol:protein length:170  variable lymphocyte receptor VLRB.2D
MACPSQCSCSGTTVDCSGKSLASVPTGIPTTTQVLYLYDNRITKLEPGVFDRLTQLTRL
DLDNNQLTVLPAGVFDKLTQLTQLSLNDNQLKSIPRGAFDNLRSLTHIWLLNNPWDCAC
SDILYLSRWISQHPWLVFGYLNLDHDSARCSGTNTPVRAVTKASTSPSKCPG