>3g73_B mol:protein length:142  Forkhead box protein M1
GPGPSRPSASWQNSVSERPPYSYMAMIQFAINSTERKRMTLKDIYTWIEDHFPYFKHIA
KPGWKNSIRHNLSLHDMFVRETSANGKVSFWTIHPSANRYLTLDQVFKPLDPGSPQLPE
HLESQQKRPNPELRRNMTIKTELP