>3gge_B mol:protein length:95  PDZ domain-containing protein GIPC2
SMKGIEKEVNVYKSEDSLGLTITDNGVGYAFIKRIKDGGVIDSVKTICVGDHIESINGE
NIVGWRHYDVAKKLKELKKEELFTMKLIEPKKSSEA