>3h0g_F mol:protein length:142  DNA-directed RNA polymerases I, II, and III subunit RPABC2
MSDYEEDEAFGMDGAVMEEEVDELEMIDENGQSQQGVSHPGEPSTTVITEDVASSKTAQ
SGKAVAKEDRTTTPYMTKYERARILGTRALQISMNAPVLVDLEGETDPLQIAMKELAQK
KIPLLVRRYLPDGSYEDWSVAELI