>3h0g_I mol:protein length:113  DNA-directed RNA polymerase II subunit RPB9
MSNFQYCIECNNMLYPREDKVDRVLRLACRNCDYSEIAATSKVYRHELQSSNVENTTVS
HDASTDPTLPRSDKECPRCHQHEAVFYQTHSRRGDTMMTLIYVCVHCGFAFEEQ