>3h0g_J mol:protein length:71  DNA-directed RNA polymerases I, II, and III subunit RPABC5
MIIPIRCFSCGKVIGDKWDTYLTLLQEDNTEGEALDKLGLQRYCCRRMILTHVDLIEKL
LCYNPLSKQKNL