>3h0g_X mol:protein length:63  DNA-directed RNA polymerases I, II, and III subunit RPABC4
MNHPTSTGGTAFNPPRPATMIYLCADCGARNTIQAKEVIRCRECGHRVMYKMRTKRMVQ
FEAR