>3h13_A mol:protein length:272  CASP8 and FADD-like apoptosis regulator
KEQRLKEQLGAQQEPVKKSIQESEAFLPQSIPEERYKMKSKPLGICLIIDCIGNETELL
RDTFTSLGYEVQKFLHLSMHGISQILGQFACMPEHRDYDSFVCVLVSRGGSQSVYGVDQ
THSGLPLHHIRRMFMGDSCPYLAGKPKMFFIQNYVVSEGQLENSSLLEVDGPAMKNVEF
KAQKRGLCTVHREADFFWSLCTADMSLLEQSHSSPSLYLQCLSQKLRQERKRPLLDLHI
ELNGYMYDWNSRVSAKEKYYVWLQHTLRKKLILSYT