>3h1i_F mol:protein length:110  UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX 14 KDA PROTEIN
AARATVAGGGRLMDRIRKWYYNAAGFNKYGLMRDDTLYEDDDVKEALKRLPEDLYNERM
FRIKRALDLSLKHRILPKEQWVKYEEDKPYLEPYLKEVIRERLEREAWNKK