>3h1i_U mol:protein length:77  UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX 11 KDA PROTEIN
LRGSGEEEEEELVDPLTTIREHCEQTEKCVKARERLELCDARVSSRSHTEEQCTEELFD
FLHARDHCVAHKLFNKLK