>3h1j_B mol:protein length:441  MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE PROTEIN 2
SLKVAPKVAVSAAAERVKLCPGAEDLEITKLPNGLIIASLENFSPASRIGVFIKAGSRY
ETTANLGTAHLLRLASPLTTKGASSFRITRGIEAVGGSLSVYSTREKMTYCVECLRDHV
DTVMEYLLNVTTAPEFRPWEVTDLQPQLKVDKAVAFQSPQVGVLENLHAAAYKTALANP
LYCPDYRIGKITSEQLHHFVQNNFTSARMALVGIGVKHSDLKQVAEQFLNIRSGAGTSS
AKATYWGGEIREQNGHSLVHAAVVTEGAAVGSAEANAFSVLQHVLGAGPLIKRGSSVTS
KLYQGVAKATTQPFDASAFNVNYSDSGLFGFYTISQAAHAGEVIRAAMNQLKAAAQGGV
TEEDVTKAKNQLKATYLMSVETAQGLLNEIGSEALLSGTHTAPSVVAQKIDSVTSADVV
NAAKKFVSGKKSMAASGDLGSTPFLDEL