>3h1j_R mol:protein length:196  Cytochrome b-c1 complex subunit Rieske, mitochondrial
VHNDVTVPDFSAYRREDVMDATTSSQTSSEDRKGFSYLVTATACVATAYAAKNVVTQFI
SSLSASADVLALSKIEIKLSDIPEGKNVAFKWRGKPLFVRHRTQAEINQEAEVDVSKLR
DPQHDLDRVKKPEWVILVGVCTHLGCVPIANSGDFGGYYCPCHGSHYDASGRIRKGPAP
YNLEVPTYQFVGDDLVVVG