>3h44_C mol:protein length:70  C-C motif chemokine 3
ASLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWV
QKYVSDLELSA