>3h4b_P mol:na length:7  5'-D(*AP*GP*GP*AP*CP*CP*(DOC))-3'
AGGACCC
>3h4b_T mol:na length:9  5'-D(*TP*(BRU)P*GP*GP*GP*TP*CP*CP*T)-3'
TUGGGTCCT
>3h4b_A mol:protein length:390  DNA polymerase iota
ASSRVIVHVDLDCFYAQVEMISNPELKDKPLGVQQKYLVVTCNYEARKLGVKKLMNVRD
AKEKCPQLVLVNGEDLTRYREMSYKVTELLEEFSPVVERLGFDENFVDLTEMVEKRLQQ
LQSDELSAVTVSGHVYNNQSINLLDVLHIRLLVGSQIAAEMREAMYNQLGLTGCAGVAS
NKLLAKLVSGVFKPNQQTVLLPESCQHLIHSLNHIKEIPGIGYKTAKCLEALGINSVRD
LQTFSPKILEKELGISVAQRIQKLSFGEDNSPVILSGPPQSFSEEDSFKKCSSEVEAKN
KIEELLASLLNRVCQDGRKPHTVRLIIRRYSSEKHYGRESRQCPIPSHVIQKLGTGNYD
VMTPMVDILMKLFRNMVNVKMPFHLTLLSVCFCNLK
>3h4b_T mol:na length:9  5'-D(*TP*(BRU)P*GP*GP*GP*TP*CP*CP*T)-3'
TUGGGTCCT